PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G013142.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family G2-like
Protein Properties Length: 405aa    MW: 45063.3 Da    PI: 6.8541
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G013142.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.62.5e-32257312156
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                           k+r++W+peLH+rFv+a++qLGGs++AtPk+i+elm+v+gLt+++vkSHLQk+Rl+
  HL.SW.v1.0.G013142.1 257 KQRRCWSPELHRRFVNALQQLGGSQVATPKQIRELMQVDGLTNDEVKSHLQKFRLH 312
                           79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.97E-18254315IPR009057Homeodomain-like
PROSITE profilePS5129413.44254314IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-28255315IPR009057Homeodomain-like
TIGRFAMsTIGR015578.0E-27257312IPR006447Myb domain, plants
PfamPF002495.1E-7259309IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 405 aa     Download sequence    Send to blast
MGSIPSELSL DFRASYVPKS IHEFLNEVSS IENVSERATK LGDFVRRLEE EMKKIDAFKR  60
ELPLCMVLLS DAILALKKES SQCAVTTNPQ PVLEEFIPLK KDCEEEDEEH EEKNKNKSEK  120
DSRDKKNWMS SVQLWNTDDI SSSDHITKNL KQNSKTQTKM SNEKVLKIED PFQSCRDRTS  180
GRAFAPFIKP YSGFLVRKEE KDEFSIPGLS LLTPGLKNPK EESGCGSGRS NSGRAVSSSP  240
ANVHSNLRIG SQQTARKQRR CWSPELHRRF VNALQQLGGS QVATPKQIRE LMQVDGLTND  300
EVKSHLQKFR LHTRRVPSGT SAHANQSVVV LGGLWMSPDQ YGDSSKASSA QSGSPQGPLQ  360
LAATRGGSPT TGDDDSMEDD DDDDAKSEGF SWKNHLHKTL KDDV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010107986.10.0Two-component response regulator
TrEMBLW9S9080.0W9S908_9R
STRINGVIT_03s0063g01060.t011e-168(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.12e-54G2-like family protein